Invitrogen™ Human MAPKBP1 (aa 991-1077) Control Fragment Recombinant Protein

Product Code. 30202982

Brand: Invitrogen™ RP94987

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56570 (PA5-56570. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP kinases play a significant role in many biological processes, including cell adhesion and spreading, cell differentiation and apoptosis. MAPKBP-1 (mitogen-activated protein kinase binding protein 1), also known as JNKBP-1, is a 1,514 amino acid protein that contains twelve WD repeats. Induced by TRAF2 (TNF receptor-associated factor 2) and Tak1 (TGF-beta-activated kinase 1), MAPKBP-1 is thought to act an adaptor protein for NFkappaB (nuclear factor kappa-B) activation. MAPKBP-1 interacts with JNK3 and may promote TRAF2 polyubiquitination. MAPKBP-1 exists as six alternatively spliced variants and is encoded by a gene located on human chromosome 15. Human chromosome 15 houses over 700 genes and comprises nearly 3% of the human genome. Angelman syndrome, Prader-Willi syndrome, Tay-Sachs disease and Marfan syndrome are all associated with defects in chromosome 15-localized genes.

Specifications

• Accession Number: O60336
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23005
• Name: Human MAPKBP1 (aa 991-1077) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810483F24Rik; AW123212; JNK-binding protein 1; JNKBP1; JNKBP-1; Jun N-terminal kinase binding protein 1; Jun N-terminal kinase-binding protein 1; KIAA0596; Mapkbp1; mitogen activated protein kinase binding protein 1; mitogen-activated protein kinase binding protein 1; mitogen-activated protein kinase-binding protein 1; mKIAA0596
• Common Name: MAPKBP1
• Gene Symbol: Mapkbp1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EKHSPDSACSVDYSSSCLSSPEHPTEDSESTEPLSVDGISSDLEEPAEGDEEEEEEEGGMGPYGLQEGSPQTPDQEQFLKQHFETLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining