Invitrogen™ Human MAP7D1 (aa 744-841) Control Fragment Recombinant Protein

Product Code. 30197882

Brand: Invitrogen™ RP94095

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP7D1 (MAP7 Domain Containing 1) is a Protein Coding gene.

Specifications

• Accession Number: Q3KQU3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55700
• Name: Human MAP7D1 (aa 744-841) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: arginine/proline rich coiled-coil 1; arginine/proline-rich coiled-coil domain-containing protein 1; AV028413; BC019977; FLJ10350; FLJ39022; KIAA1187; MAP7 domain containing 1; MAP7 domain-containing protein 1; MAP7D1; microtubule-associated protein 7 domain containing 1; mKIAA1187; Mtap7d1; Parcc1; PP2464; proline arginine rich coiled coil 1; proline/arginine-rich coiled-coil domain-containing protein 1; Rprc1
• Common Name: MAP7D1
• Gene Symbol: Map7d1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPVKAVEARSPGLQKEAVQKEEPIPQEPQWSLPSKELPASLVNGLQPLPAHQENGFSTNGPSGDKSLSRTPETLLPFAEAEAFLKKAVVQSPQVTEVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining