Invitrogen™ Human MAP6 (aa 387-499) Control Fragment Recombinant Protein

Product Code. 30197618

Brand: Invitrogen™ RP97466

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58640 (PA5-58640. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STOP encodes a microtubule-associated protein. The encoded protein is a calmodulin-binding and calmodulin-regulated protein that is involved in microtubule stabilization. Two transcript variants encoding distinct isoforms have been identified for this gene.

Specifications

• Accession Number: Q96JE9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4135
• Name: Human MAP6 (aa 387-499) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 145-kDa STOP; 2810411E12Rik; CTD-2530H12.7; KIAA1878; LOW QUALITY PROTEIN: microtubule-associated protein 6; MAP6; MAP-6; MAP6-N; microtubule associated protein 6; microtubule-associated protein 6; microtubule-associated protein 6 homolog; Mtap6; N STOP; N-STOP; Stable tubule-only polypeptide; STOP; STOP145
• Common Name: MAP6
• Gene Symbol: Map6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TSASHKPTRKAKDKQAVSGQAAKKKSAEGPSTTKPDDKEQSKEMNNKLAEAKESLAQPVSDSSKTQGPVATEPDKDQGSVVPGLLKGQGPMVQEPLKKQGSVVPGPPKDLGPM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining