Invitrogen™ Human MAP1S (aa 815-902) Control Fragment Recombinant Protein

Product Code. 30211294

Brand: Invitrogen™ RP101273

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62272 (PA5-62272. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved in the formation of microtubule bundles.

Specifications

• Accession Number: Q66K74
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55201
• Name: Human MAP1S (aa 815-902) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BPY2 interacting protein 1; BPY2-interacting protein 1; BPY2IP1; C19orf5; MAP1S; MAP-1 S; MAP1S heavy chain; MAP1S light chain; MAP8; microtubule associated protein 1 S; microtubule-associated protein 1 S; Microtubule-associated protein 8; variable charge Y chromosome 2-interacting protein 1; VCY2 interacting protein 1; VCY2-interacting protein 1; VCY2IP1; VCY2IP-1
• Common Name: MAP1S
• Gene Symbol: MAP1S
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSAR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining