Invitrogen™ Human MAP1 (aa 112-186) Control Fragment Recombinant Protein

Product Code. 30199255

Brand: Invitrogen™ RP109603

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140199 (PA5-140199. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apoptosis plays a major role in normal organism development, tissue homeostasis, and removal of damaged cells. Disruption of this process has been implicated in a variety of diseases such as cancer. Members of the Bcl-2 family are known to be critical regulators of this process. These proteins are characterized by the presence of several conserved motifs termed Bcl-2 homology (BH) domains. A related protein termed MAP-1 has recently been identified. This protein contains a BH3-like domain and induces caspase-dependent apoptosis in mammalian cells when overexpressed. It forms homodimers and associates with Bcl-2 family members such as Bax, Bcl-2, and Bcl-XL in vitro and in vivo. It has been suggested that MAP-1 associates with the tumor suppressor RASSF1A following death receptor activation, allowing a conformational change in Bax that leads to cellular apoptosis.

Specifications

• Accession Number: Q96BY2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64112
• Name: Human MAP1 (aa 112-186) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA987038; MAP1; Map-1; Moap1; Modulator of apoptosis 1; paraneoplastic antigen like 4; paraneoplastic antigen Ma4; paraneoplastic Ma antigen family member 4; PNMA4
• Common Name: MAP1
• Gene Symbol: MOAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining