Invitrogen™ Human MAOA (aa 459-499) Control Fragment Recombinant Protein

Product Code. 30199152

Brand: Invitrogen™ RP103348

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63700 (PA5-63700. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes monoamine oxidase A, an enzyme that degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the mitochondrial outer membrane. The gene is adjacent to a related gene on the opposite strand of chromosome X. Mutation in this gene results in monoamine oxidase deficiency, or Brunner syndrome.

Specifications

• Accession Number: P21397
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4128
• Name: Human MAOA (aa 459-499) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110061B18Rik; AA407771; Amine oxidase [flavin-containing] A; HGNC:6833; Mao; MAOA; MAO-A; monoamine oxidase A; monoamine oxidase type A; RP1-201D17__B0.2
• Common Name: MAOA
• Gene Symbol: MAOA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining