Invitrogen™ Human MANEAL (aa 108-141) Control Fragment Recombinant Protein

Product Code. 30200591

Brand: Invitrogen™ RP107234

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66582 (PA5-66582. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MANEAL is a protein coding gene. Gene Ontology (GO) annotations related to this gene include hydrolase activity, acting on glycosyl bonds.

Specifications

• Accession Number: Q5VSG8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 149175
• Name: Human MANEAL (aa 108-141) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: glycoprotein endo-alpha-1,2-mannosidase-like protein; Gm50; maneal; mannosidase endo-alpha like; mannosidase, endo-alpha-like; RGD1563973; si:ch211-30b16.2
• Common Name: MANEAL
• Gene Symbol: MANEAL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FYYSWYGSPRREGHYIHWDHVMVPHWDPKISASY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining