Invitrogen™ Human MAN2A2 (aa 729-809) Control Fragment Recombinant Protein

Product Code. 30194474

Brand: Invitrogen™ RP108694

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85045 (PA5-85045. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway.

Specifications

• Accession Number: P49641
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4122
• Name: Human MAN2A2 (aa 729-809) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700052O22Rik; 4931438M07Rik; AI480988; alpha mannosidase IIx; alpha-mannosidase 2 x; Alpha-mannosidase IIx; MAN IIx; Man2a2; Mana2x; mannosidase 2, alpha 2; mannosidase alpha class 2 A member 2; mannosidase, alpha type II-X; mannosidase, alpha, class 2 A, member 2; mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase; manosidase, alpha-, type II, isozyme X; MX
• Common Name: MAN2A2
• Gene Symbol: MAN2A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining