Invitrogen™ Human Mammaglobin B (aa 23-93) Control Fragment Recombinant Protein

Product Code. 30193568

Brand: Invitrogen™ RP95119

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (35%), Rat (35%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56981 (PA5-56981. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Secretoglobins (also called lipophilins or mammaglobins) are small secreted proteins of ndocrine-responsive organs and mucosal epithelia that form multimeric complexes and correlate with the development of various human cancers. Lipophilin A and Lipophilin B are orthologs of prostatein estramustine- binding protein), the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin A, also designated LIPA, LPHA and secretoglobin, family 1D, member 1 (SCGB1D1), is a component of a heterodimeric molecule present in human tears. Lipophilin B, also designated LIPB, LPHB and secretoglobin, family 1D, member 2 (SCGB1D2), mRNA can be overexpressed in breast tumors and shows a high degree of correlation with the mRNA expression profile of mammaglobin. Histological detection in breast tissue of Mammaglobin A, also designated MGB1 and secretoglobin, family 2A, member 2 (SCGB2A2) and Mammaglobin B, also designated MGB2, Lipophilin C, LPHC, UGB3 and SCGB2A2, is a reliable diagnostic marker for breast tumors.

Specifications

• Accession Number: O75556
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4246
• Name: Human Mammaglobin B (aa 23-93) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C3.1; Lacryglobin; LIPHC; lipophilin C; lipophilin-C; LPHC; LPNC; mammaglobin 2; mammaglobin B; mammaglobin-2; Mammaglobin-B; MGB2; prostatein; Prostatein peptide C3; Prostatic steroid-binding protein C3; Psbp1; Psbpc3; SCGB2A1; Scgb2a2; Secretoglobin family 2 A member 1; Secretoglobin family 2 A member 2; secretoglobin, family 2 A, member 1; UGB3
• Common Name: Mammaglobin B
• Gene Symbol: SCGB2A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining