Invitrogen™ Human MAML1 (aa 713-791) Control Fragment Recombinant Protein

Product Code. 30199960

Brand: Invitrogen™ RP106782

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein is the human homolog of mastermind, a Drosophila protein that plays a role in the Notch signaling pathway involved in cell-fate determination. There is in vitro evidence that the human homolog forms a complex with the intracellular portion of human Notch receptors and can increase expression of a Notch-induced gene. This evidence supports its proposed function as a transcriptional co-activator in the Notch signaling pathway.

Specifications

• Accession Number: Q92585
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9794
• Name: Human MAML1 (aa 713-791) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI644666; AW743257; D930008C07Rik; FLJ53540; KIAA0200; Mam1; Mam-1; MAML1; mastermind homolog; mastermind like 1 (Drosophila); mastermind like transcriptional coactivator 1; mastermind-like 1; mastermind-like protein 1; mastermind-like transcriptional coactivator 1; mKIAA0200
• Common Name: MAML1
• Gene Symbol: MAML1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PQAGNLMPMGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQPPPQATNGHAHIPRQTNVGQNT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining