Invitrogen™ Human MAMDC4 (aa 35-109) Control Fragment Recombinant Protein

Product Code. 30198054

Brand: Invitrogen™ RP106980

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66300 (PA5-66300. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probably involved in the sorting and selective transport of receptors and ligands across polarized epithelia. Target protein is a glycoprotein localized to the apical endosomal tubules of intestinal epithelial cells; may play a role in intestinal transport.

Specifications

• Accession Number: Q6UXC1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 158056
• Name: Human MAMDC4 (aa 35-109) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AEGP; apical early endosomal glycoprotein; apical endosomal glycoprotein; endotubin; MAM domain containing 4; MAM domain-containing protein 4; MAMDC4; UNQ3001/PRO9742
• Common Name: MAMDC4
• Gene Symbol: MAMDC4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VCNFVCDCRDCSDEAQCGYHGASPTLGAPFACDFEQDPCGWRDISTSGYSWLRDRAGAALEGPGPHSDHTLGTDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining