missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAGI3 (aa 897-1037) Control Fragment Recombinant Protein

Product Code. 30203291
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203291

Brand: Invitrogen™ RP89519

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-110738 (PA5-110738, PA5-64925 (PA5-64925. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Membrane-associated guanylate kinase with inverted orientation (MAGI3) is a novel, 130 kDa guanylate kinase which is part of a family of multi-PDZ domain containing guanylate kinases. These guanylate kinases are localized to epithelial cell tight junctions. MAGI3 and PTEN/MMAC cooperate to modulate the kinase activity of AKT/protein kinase B (PKB). MAGI3 positions the PTEN/MMAC phosphatase to specific subcellular locations that are involved with the regulation of cell proliferation and survival. MAGI3, as well as other proteins in this family, are made up of an N-terminal guanylate kinase domain, followed by a WW domain, named for two conserved tryptophan residues and first identified as two repeats in mouse YAP65, which is them followed by 5 PDZ domains.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5TCQ9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 260425
Name Human MAGI3 (aa 897-1037) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4732496O19Rik; 6530407C02Rik; AA407180; AI120132; dJ730K3.2; GKWW domain; KIAA1634; Magi3; MAGI-3; membrane associated guanylate kinase, WW and PDZ domain containing 3; membrane-associated guanylate kinase inverted 3; Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3; membrane-associated guanylate kinase-related (MAGI-3); membrane-associated guanylate kinase-related 3; mKIAA1634; PDZ 4-5; RP4-730K3.1; scaffolding protein SLIPR; scaffolding-like protein; Slipr
Common Name MAGI3
Gene Symbol MAGI3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLRG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.