Invitrogen™ Human MAGI3 (aa 897-1037) Control Fragment Recombinant Protein

Product Code. 30203291

Brand: Invitrogen™ RP89519

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-110738 (PA5-110738, PA5-64925 (PA5-64925. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Membrane-associated guanylate kinase with inverted orientation (MAGI3) is a novel, 130 kDa guanylate kinase which is part of a family of multi-PDZ domain containing guanylate kinases. These guanylate kinases are localized to epithelial cell tight junctions. MAGI3 and PTEN/MMAC cooperate to modulate the kinase activity of AKT/protein kinase B (PKB). MAGI3 positions the PTEN/MMAC phosphatase to specific subcellular locations that are involved with the regulation of cell proliferation and survival. MAGI3, as well as other proteins in this family, are made up of an N-terminal guanylate kinase domain, followed by a WW domain, named for two conserved tryptophan residues and first identified as two repeats in mouse YAP65, which is them followed by 5 PDZ domains.

Specifications

• Accession Number: Q5TCQ9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 260425
• Name: Human MAGI3 (aa 897-1037) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4732496O19Rik; 6530407C02Rik; AA407180; AI120132; dJ730K3.2; GKWW domain; KIAA1634; Magi3; MAGI-3; membrane associated guanylate kinase, WW and PDZ domain containing 3; membrane-associated guanylate kinase inverted 3; Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3; membrane-associated guanylate kinase-related (MAGI-3); membrane-associated guanylate kinase-related 3; mKIAA1634; PDZ 4-5; RP4-730K3.1; scaffolding protein SLIPR; scaffolding-like protein; Slipr
• Common Name: MAGI3
• Gene Symbol: MAGI3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLRG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining