missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201302

Invitrogen™ Human MAGEF1 (aa 87-153) Control Fragment Recombinant Protein

Product Code. 30201302
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201302

Brand: Invitrogen™ RP104991

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65848 (PA5-65848. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Melanoma-associated antigen (MAGE) are completely silent in normal tissues, with the exception of male germ cells, and, for some of them, placenta. These antigens ought to be strictly tumor specific, expressed in tumor cells of various histological types. Because of their specific expression on tumor cells, these antigens are of particular interest for antitumor immunotherapy. Genes of the MAGE family direct the expression of tumor antigens that are recognized on a human melanoma by autologous cytolytic T lymphocytes. Though the function of MAGE is unknown, may play a role in embryonal development and tumor transformation or aspects of tumor progression.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9HAY2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64110
Name Human MAGEF1 (aa 87-153) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6430590I03Rik; MAGE family member F1; MAGEF1; MAGE-F1; MAGE-F1 antigen; MAGF1; melanoma antigen family F, 1; melanoma antigen family F1; melanoma-associated antigen F1; MGC19617
Common Name MAGEF1
Gene Symbol MAGEF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLKPLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.