Invitrogen™ Human MAGEC3 (aa 382-436) Control Fragment Recombinant Protein

Product Code. 30197699

Brand: Invitrogen™ RP100063

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62546 (PA5-62546. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAGEC3 is a member of the MAGEC gene family. The members of this family are not expressed in normal tissues, except for testis, and are expressed in tumors of various histological types. The MAGEC genes are clustered on chromosome Xq26-q27. Two transcript variants encoding distinct isoforms have been found for this gene.

Specifications

• Accession Number: Q8TD91
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 139081
• Name: Human MAGEC3 (aa 382-436) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cancer/testis antigen 7.2; cancer/testis antigen family 7, member 2; CT7.2; HCA2; hepatocellular carcinoma-associated antigen 2; hepatocellular carcinoma-associated protein HCA2; MAGE family member C3; MAGE family testis and tumor-specific protein; MAGEC3; MAGE-C3; MAGE-C3 antigen; MAGEC4; melanoma antigen family C, 3; melanoma antigen family C3; melanoma-associated antigen C3
• Common Name: MAGEC3
• Gene Symbol: MAGEC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AGMPPLPQSPPEIPPQGPPKISPQGPPQSPPQSPLDSCSSPLLWTRLDEESSSEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining