Invitrogen™ Human MAGEB5 (aa 8-53) Control Fragment Recombinant Protein

Product Code. 30198956

Brand: Invitrogen™ RP101579

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62654 (PA5-62654. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAGEB5 is a protein coding gene.

Specifications

• Accession Number: Q9BZ81
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 347541
• Name: Human MAGEB5 (aa 8-53) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700056A17Rik; Cancer/testis antigen 3.3; cancer/testis antigen family 3, member 3; CT3.3; MAGE family member B5; MAGE family testis and tumor-specific protein; MAGEB5; MAGE-B5; MAGE-B5 antigen; melanoma antigen family B, 5; melanoma antigen family B5; melanoma antigen, family B, 5; melanoma-associated antigen B5; mMage-b5
• Common Name: MAGEB5
• Gene Symbol: MAGEB5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining