Invitrogen™ Human MAF1 (aa 1-68) Control Fragment Recombinant Protein

Product Code. 30206624

Brand: Invitrogen™ RP93931

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55195 (PA5-55195. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is similar to Maf1, a Saccharomyces cerevisiae protein highly conserved in eukaryotic cells. Yeast Maf1 is a negative effector of RNA polymerase III (Pol III). It responds to changes in the cellular environment and represses pol III transcription. Biochemical studies identified the initiation factor TFIIIB as a target for Maf1-dependent repression.

Specifications

• Accession Number: Q9H063
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84232
• Name: Human MAF1 (aa 1-68) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110068E11Rik; AU042856; homolog of yeast MAF1; MAF1; MAF1 homolog (S. cerevisiae); MAF1 homolog, negative regulator of RNA polymerase III; MAF1 negative regulator of RNA polymerase III; repressor of RNA polymerase III transcription MAF1 homolog
• Common Name: MAF1
• Gene Symbol: MAF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining