Invitrogen™ Human MACROD1 (aa 100-166) Control Fragment Recombinant Protein

Product Code. 30212806

Brand: Invitrogen™ RP97320

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59402 (PA5-59402. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Removes ADP-ribose from glutamate residues in proteins bearing a single ADP-ribose moiety. Inactive towards proteins bearing poly-ADP-ribose. Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins. Plays a role in estrogen signaling. Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen. May play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation. Could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction. Could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells. Enhances ESR1-mediated transcription activity.

Specifications

• Accession Number: Q9BQ69
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 28992
• Name: Human MACROD1 (aa 100-166) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: [Protein ADP-ribosylaspartate] hydrolase MACROD1; [Protein ADP-ribosylglutamate] hydrolase; [Protein ADP-ribosylglutamate] hydrolase MACROD1; ADP-ribose glycohydrolase MACROD1; ADP-ribose glycohydrolase MACROD1; O-acetyl-ADP-ribose deacetylase MACROD1; AI604841; AW743046; D930010J01Rik; LOC613568 protein; Lrp16; MACRO domain containing 1; MACRO domain-containing protein 1; MACROD1; mono-ADP ribosylhydrolase 1; O-acetyl-ADP-ribose deacetylase MACROD1; O-acetyl-ADP-ribose deacetylase MACROD1; LOW QUALITY PROTEIN: O-acetyl-ADP-ribose deacetylase MACROD1; Protein LRP16
• Common Name: MACROD1
• Gene Symbol: MACROD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining