Invitrogen™ Human MACC1 (aa 9-77) Control Fragment Recombinant Protein

Product Code. 30213058

Brand: Invitrogen™ RP92823

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54148 (PA5-54148. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MACC1 (Metastasis associated in colon cancer 1) is a key regulator of the hepatocyte growth factor (HGF)-HGF receptor (MET) pathway, which is involved in cellular growth, epithelial-mesenchymal transition, angiogenesis, cell motility, invasiveness, and metastasis. MACC1 protein consists of four domains: ZU5, SH3, and two C-terminal death domains (DD). Expression of MACC1 was found significantly upregulated in malignant tissues (colon cancer of all stages as well as liver and lung metastases) compared to normal tissues or adenomas. MACC1 represents an early and crucial prognostic indicator for colon cancer metastasis that is independent of age, sex, tumor infiltration, nodal status, and lymph vessel invasion. Besides its involvement in signal transduction with the MET receptor, MACC1 also links MET signaling and apoptosis. MACC1 may also be an important therapeutic target for colorectal cancer treatment. At least two isoforms of MACC1 are known to exist.

Specifications

• Accession Number: Q6ZN28
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 346389
• Name: Human MACC1 (aa 9-77) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4732474O15Rik; 7A5; Gm267; MACC1; metastasis associated in colon cancer 1; metastasis-associated in colon cancer protein 1; putative binding protein 7a5; RGD1309838; SH3 domain-containing protein 7a5; SH3BP4L
• Common Name: MACC1
• Gene Symbol: MACC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining