Invitrogen™ Human MAB21L1 (aa 70-150) Control Fragment Recombinant Protein

Product Code. 30212482

Brand: Invitrogen™ RP105636

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66289 (PA5-66289. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.

Specifications

• Accession Number: Q13394
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4081
• Name: Human MAB21L1 (aa 70-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW047968; CAGR1; Mab21; mab-21 like 1; MAB21L1; mab-21-like 1 (C. elegans); mab-21-like protein 1; mb211; Nbla00126; protein mab-21-like 1; Putative nucleotidyltransferase MAB21L1
• Common Name: MAB21L1
• Gene Symbol: MAB21L1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining