missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208231

Invitrogen™ Human MA2 (aa 58-206) Control Fragment Recombinant Protein

Product Code. 30208231
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208231

Brand: Invitrogen™ RP102104

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81995 (PA5-81995. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In patients with cancer, symptoms of limbic and brain-stem dysfunction may result from a para-neoplastic disorder. Two proteins, Ma1 and Ma2, were discovered by presence of autoantibodies against them. Antibodies to Ma1 and Ma2 proteins identify a paraneoplastic disorder that affects the limbic system, brain stem, and cerebellum. These autoantibodies were used to clone Ma2, which codes for a protein (Ma2) that was recognized by serum from the 10 patients, but not by serum from 344 control subjects. Ma2 was selectively expressed by normal brain tissue and by the testicular tumors of the patients. Ma2 shares homology with Ma1, a 'brain-testis-cancer' gene related to other para-neoplastic syndromes and tumors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UL42
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10687
Name Human MA2 (aa 58-206) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 40 kDa neuronal protein; A830049P17Rik; KIAA0883; MA2; mKIAA0883; MM2; onconeuronal antigen MA2; Paraneoplastic antigen Ma2; paraneoplastic antigen Ma2 homolog; paraneoplastic Ma antigen 2; paraneoplastic neuronal antigen MM2; Pnma2; retrotransposon gag domain containing 2; RGAG2
Common Name MA2
Gene Symbol PNMA2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPELLAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPVTEAEKKRWL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.