Invitrogen™ Human M1AP (aa 32-128) Control Fragment Recombinant Protein

Product Code. 30209698

Brand: Invitrogen™ RP106925

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66244 (PA5-66244. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in gametogenesis.

Specifications

• Accession Number: Q8TC57
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 130951
• Name: Human M1AP (aa 32-128) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C2orf65; D6Mm5e; M1AP; Meiosis 1 arrest protein; meiosis 1 arresting protein; meiosis 1 associated protein; meiosis 1-arresting protein; Meiosis 1-associated protein; RGD1563842; Spata37; spermatogenesis associated 37; spermatogenesis-associated protein 37
• Common Name: M1AP
• Gene Symbol: M1AP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQDQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining