missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human M-cadherin (aa 322-396) Control Fragment Recombinant Protein

Product Code. 30201653
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201653

Brand: Invitrogen™ RP107782

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111666 (PA5-111666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cadherins are a multigene family of Ca++-dependent cell adhesion molecules. They are transmembrane glycoproteins consisting of an extracellular domain, which mediates Ca++-dependent intercellular adhesion by homophilic interactions, a transmembrane region and a cytoplasmic domain. The extracellular domain is divided into a series of subdomains designated EC1-EC5. Homolgies between different members of the cadherin family are most prominent in the cytoplasmic domain and in EC1 and EC2 and much less so in EC5 of the extracellular domain and in the transmembrane region. The binding properties and specificities of the adhesive function are located in the N-terminal part of the molecules. Four members of the cadherin family have been identified and molecularly cloned from mammalian cells. These include the neuronal (N), epithelial (E), placental (P) and muscle (M) cadherins. M-cadherin is not found in fibroblasts but is expressed at low level in myoblasts and is upregulated following induction of myotube formation, suggesting a specific function in skeletal muscle cell differentiation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P55291
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1013
Name Human M-cadherin (aa 322-396) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI323380; cadherin 15; cadherin 15, type 1, M-cadherin (myotubule); cadherin-14; Cadherin-15; cadherin-3; Cdh14; Cdh15; CDH3; CDHM; CRSBP-1; HAR; LYVE-1; M cadherin; Mcad; M-cadherin; MRD3; Muscle cadherin; muscle-cadherin; XLKD1
Common Name M-cadherin
Gene Symbol CDH15
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.