missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LZTR1 (aa 378-465) Control Fragment Recombinant Protein

Product Code. 30196919
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196919

Brand: Invitrogen™ RP109142

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LZTR1, a member of the BTB-kelch superfamily, was initially described as a putative transcriptional regulator based on weak homology to members of the basic leucine zipper-like family, the encoded protein subsequently has been shown to localize exclusively to the Golgi network where it may help stabilize the Golgi complex. Deletion of this gene may be associated with DiGeorge syndrome, a developmental field defect involving the third and fourth pharyngeal pouches, causing the absence of thymus and parathyroid glands, congenital cardiac abnormalities and facial dysmorphism. LZTR1 is tyrosine phosphorylated and subsequently degraded upon induction of apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N653
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8216
Name Human LZTR1 (aa 378-465) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200003E21Rik; AI591627; AW550890; BTBD29; fj87c05; leucine zipper like transcription regulator 1; leucine-zipper-like transcription regulator 1; leucine-zipper-like transcriptional regulator 1; leucine-zipper-like transcriptional regulator, 1; Lztr1; LZTR-1; MGC21205; NS10; si:dkey-98f17.2; SWNTS2; Tcfl2; wu:fj87c05; zgc:158250
Common Name LZTR1
Gene Symbol LZTR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TQPASELPSGRLFHAAAVISDAMYIFGGTVDNNIRSGEMYRFQFSCYPKCTLHEDYGRLWESRQFCDVEFVLGEKEECVQGHVAIVTA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.