missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LYVE1 (aa 82-231) Control Fragment Recombinant Protein

Product Code. 30206491
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206491

Brand: Invitrogen™ RP102930

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111168 (PA5-111168. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LYVE1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module, the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves. LYVE1 is a type I integral membrane glycoprotein. LYVE-1 is expressed primarily on lymphatic vessel endothelium and is likely to be involved in regulating the traffic of leucocytes and tumor cells to lymph nodes. The lymphatic vasculature forms a second circulatory system that drains extracellular fluid from the tissues and provides an exclusive environment in which immune cells can encounter and respond to foreign antigen. A number of molecules have been identified as markers for lymphatic endothelium which include LYVE1, PALE, VEGFR3, and podoplanin. Diseases associated with LYVE1 dysfunction includes Complete Androgen Insensitivity Syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y5Y7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10894
Name Human LYVE1 (aa 82-231) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200012G08Rik; cell surface retention sequence binding protein-1; cell surface retention sequence-binding protein 1; CRSBP1; CRSBP-1; extra cellular link domain-containing 1; extracellular link domain containing 1; extracellular link domain-containing 1; extracellular link domain-containing protein 1; HAR; hyaluronic acid receptor; lymphatic endothelial hyaluronan receptor LYVE-1; lymphatic vessel endothelial HA receptor-1; lymphatic vessel endothelial HA recptor-1; lymphatic vessel endothelial hyaluronan receptor 1; lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE1; LYVE-1; sLyve 1; sLyve1; soluble LYVE 1; soluble LYVE1; UNQ230/PRO263; XLKD1
Common Name LYVE1
Gene Symbol Lyve1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.