Invitrogen™ Human LYSMD1 (aa 146-227) Control Fragment Recombinant Protein

Product Code. 30209277

Brand: Invitrogen™ RP94422

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55755 (PA5-55755. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LYSMD1 (LysM Domain Containing 1) is a Protein Coding gene. Diseases associated with LYSMD1 include 3-Methylglutaconic Aciduria, Type Vii. An important paralog of this gene is LYSMD2. [GeneCards]

Specifications

• Accession Number: Q96S90
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 388695
• Name: Human LYSMD1 (aa 146-227) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610022K04Rik; AI415311; lysM and putative peptidoglycan-binding domain-containing protein 1; LysM domain containing 1; LysM, putative peptidoglycan-binding, domain containing 1; Lysmd1; RP11-68I18.5; SB145
• Common Name: LYSMD1
• Gene Symbol: LYSMD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining