Invitrogen™ Human LYRM7 (aa 12-104) Control Fragment Recombinant Protein

Product Code. 30205428

Brand: Invitrogen™ RP100275

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62126 (PA5-62126. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q5U5X0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90624
• Name: Human LYRM7 (aa 12-104) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C5orf31; Complex III assembly factor LYRM7; LYR motif containing 7; LYR motif-containing protein 7; LYRM7; Lyrm7 homolog; MC3DN8; MZM1L
• Common Name: LYRM7
• Gene Symbol: LYRM7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining