missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196622

Invitrogen™ Human Lymphotactin (aa 68-114) Control Fragment Recombinant Protein

Product Code. 30196622
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196622

Brand: Invitrogen™ RP104515

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63473 (PA5-63473. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lymphotactin, otherwise known as XCL1, is a member of the C-chemokine family that uniquely acts as a chemoattractant for lymphocytes, but not monocytes or neutrophils, suggesting an important regulatory role in lymphocyte trafficking and inflammation. Lymphotactin, shown to signal through chemokine XC receptor 1 (XCR1), is detected at the highest level in the spleen and at low levels in the lungs, small intestine and colon, and is abundantly and selectively expressed by activated T cells, in particular CD8+ T cells, and is also produced by NK cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P47992
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6375
Name Human Lymphotactin (aa 68-114) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI661682; ATAC; C motif chemokine 1; chemokine (C motif) ligand 1; cytokine SCM-1; Lptn; LTN; Lymphotactin; lymphotaxin; SCM1; SCM-1; SCM1A; SCM-1 A; SCM1alpha; SCM-1 alpha; SCM-1-alpha; SCM1beta; SCM-1 beta; SCM-1-beta; SCYC1; single cysteine motif 1 A; small inducible cytokine subfamily C, member 1 (lymphotactin); small-inducible cytokine C1; XC chemokine ligand 1; X-C motif chemokine ligand 1; XCL1
Common Name Lymphotactin
Gene Symbol Xcl1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.