Invitrogen™ Human LY6H (aa 36-76) Control Fragment Recombinant Protein

Código de producto. 30208346

missing translation for 'mfr': Invitrogen™ RP109618

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140344 (PA5-140344. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LY6H is highly expressed in particular subdivisions of human brain and also in MOLT-3 and -4 acute lymphoblastic leukemia cells. It has some isoforms with MW 14-16 kDa.

Especificaciones

• Accession Number: O94772
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4062
• Name: Human LY6H (aa 36-76) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: LY6H; Ly-6 H; lymphocyte antigen 6 complex, locus H; lymphocyte antigen 6 H; NMLY6
• Common Name: LY6H
• Gene Symbol: LY6H
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining