Invitrogen™ Human LY6G5C (aa 6-64) Control Fragment Recombinant Protein

Product Code. 30202595

Brand: Invitrogen™ RP96588

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58495 (PA5-58495. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LY6G5C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction.

Specifications

• Accession Number: Q5SRR4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80741
• Name: Human LY6G5C (aa 6-64) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C6orf20; Canine epididymal gene product 8; CE8; CE8 protein, variant 2; epididymal secretory protein 8; G5C; Ly6g5c; LY6G5CA; LY6G5CB; Lymphocyte antigen 6 complex locus protein G5c; lymphocyte antigen 6 complex, locus G5C; lymphocyte antigen 6 family member G5C; lymphocyte antigen-6 G5C; NG33; re8
• Common Name: LY6G5C
• Gene Symbol: Ly6g5c
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ADLPSCWGAGPCYTGHKVGALRRDTVICCCRHGDYSTPCLFTPGKPSRNPSPWKRTLWT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining