Invitrogen™ Human LTK (aa 781-849) Control Fragment Recombinant Protein

Product Code. 30208599

Brand: Invitrogen™ RP95226

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111490 (PA5-111490. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LTK (TYK1), ALK and Ros have been identified as receptor tyrosine kinases having sequence similarity to the Insulin receptor subfamily of kinases. LTK, leukocyte tyrosine kinase, is expressed in murine B-lymphocyte precursors and has also been found in forebrain neurons. ALK, anaplastic lymphoma kinase, is normally highly expressed specifically in the nervous system. A truncated form containing the catalytic domain of ALK is expressed as the result of a translocation occurring in many non-Hodgkin's lymphomas. The c-Ros gene was originally identified in mutant form as an oncogene. Ros is normally expressed in a small number of epithelial cell types and may play a role in epithelial development.

Specifications

• Accession Number: P29376
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4058
• Name: Human LTK (aa 781-849) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EC 2.7.1.112; EC 2.7.10.1; leukocyte receptor tyrosine kinase; leukocyte tyrosine kinase; leukocyte tyrosine kinase receptor; Ltk; Protein tyrosine kinase 1; TYK1; tyrosine kinase-1
• Common Name: LTK
• Gene Symbol: LTK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWLSSGLKPLKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining