Invitrogen™ Human LTB4R2 (aa 320-358) Control Fragment Recombinant Protein

Product Code. 30202432

Brand: Invitrogen™ RP107899

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111703 (PA5-111703. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BLTR2 has been reported in humans in peripheral blood leukocytes, mononuclear lymphocytes, and spleen. ESTs have been isolated from a broad array of human libraries, including brain, eye, fetal lung/testis/B-cell, heart, kidney, melanocyte/uterus/fetal heart, testis, tonsil, and uterus libraries.

Specifications

• Accession Number: Q9NPC1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56413
• Name: Human LTB4R2 (aa 320-358) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830462O07Rik; BLT2; Blt-2; BLT2R; BLTR2; Hblt2; JULF2; KPG_004; Leukotriene B4 receptor 2; leukotriene B4 receptor BLT2; LTB4 receptor JULF2; LTB4-R 2; LTB4R2; LTB4-R2; LTB4-R-2; NOP9; Seven transmembrane receptor BLTR2
• Common Name: LTB4R2
• Gene Symbol: LTB4R2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining