Invitrogen™ Human LTB (aa 52-121) Control Fragment Recombinant Protein

Product Code. 30210841

Brand: Invitrogen™ RP100090

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61828 (PA5-61828. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor. The minor complex is lymphotoxin-alpha 2/beta 1. LTB is an inducer of the inflammatory response system and involved in normal development of lymphoid tissue. Lymphotoxin-beta isoform b is unable to complex with lymphotoxin-alpha suggesting a function for lymphotoxin-beta which is independent of lympyhotoxin-alpha. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: Q06643
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4050
• Name: Human LTB (aa 52-121) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI662801; LTB; LTbeta; LT-beta; lymphotoxin B; lymphotoxin beta; lymphotoxin beta (TNF superfamily, member 3); lymphotoxin-beta; p33; TNF superfamily member 3; Tnfc; TNF-C; Tnfsf3; TNLG1C; tumor necrosis factor C; tumor necrosis factor ligand 1 C; tumor necrosis factor ligand superfamily member 3
• Common Name: LTB
• Gene Symbol: LTB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining