Invitrogen™ Human LTA4H (aa 40-179) Control Fragment Recombinant Protein

Product Code. 30204661

Brand: Invitrogen™ RP89566

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52553 (PA5-52553. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Specifications

• Accession Number: P09960
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4048
• Name: Human LTA4H (aa 40-179) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Leukotriene A(4) hydrolase; leukotriene A4 hydrolase; Leukotriene A-4 hydrolase; LKHA4; LTA4; LTA4 hydrodase; LTA-4 hydrolase; LTA4H; testicular secretory protein Li 27
• Common Name: LTA4H
• Gene Symbol: LTA4H
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGET
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining