Invitrogen™ Human LSAMP (aa 216-262) Control Fragment Recombinant Protein

Product Code. 30205669

Brand: Invitrogen™ RP106503

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.

Specifications

• Accession Number: Q13449
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4045
• Name: Human LSAMP (aa 216-262) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5430428I19; AW046674; B130007O04Rik; D930023J12Rik; IgLON family member 3; IGLON3; Lam; LAMP; limbic system associated membrane protein; limbic system-associated membrane protein; Lsamp; neuronal growth regulator 1-like; Unknown (protein for MGC:128495)
• Common Name: LSAMP
• Gene Symbol: Lsamp
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSAN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining