Invitrogen™ Human LRSAM1 (aa 359-446) Control Fragment Recombinant Protein

Product Code. 30198959

Brand: Invitrogen™ RP93014

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54397 (PA5-54397. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LRSAM1 is a multifunctional RING finger protein that selectively regulates cell adhesion molecules, has ubiquitin ligase activity, and plays a role in receptor endocytosis and viral budding.

Specifications

• Accession Number: Q6UWE0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90678
• Name: Human LRSAM1 (aa 359-446) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CMT2P; E3 ubiquitin-protein ligase LRSAM1; hTAL; leucine rich repeat and sterile alpha motif containing 1; leucine-rich repeat and sterile alpha motif-containing protein 1; LRSAM1; RGD1564403; RIFLE; RING-type E3 ubiquitin transferase LRSAM1; TAL; Tsg101-associated ligase; UNQ6496/PRO21356
• Common Name: LRSAM1
• Gene Symbol: Lrsam1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSSMAEMDERFQQILSWQQMDQNKAISQI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining