Invitrogen™ Human LRRN3 (aa 101-142) Control Fragment Recombinant Protein

Product Code. 30203953

Brand: Invitrogen™ RP100814

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61329 (PA5-61329. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9H3W5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54674
• Name: Human LRRN3 (aa 101-142) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: fibronectin type III, immunoglobulin and leucine rich repeat domains 5; FIGLER5; leucine rich repeat neuronal 3; leucine rich repeat protein 3, neuronal; leucine-rich repeat neuronal protein 3; leucine-rich repeat protein, neuronal 3; Lrrn3; Nbla10363; Neuronal leucine-rich repeat protein 3; NLRR3; NLRR-3; UNQ194/PRO220
• Common Name: LRRN3
• Gene Symbol: LRRN3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining