Invitrogen™ Human LRRN1 (aa 383-508) Control Fragment Recombinant Protein

Product Code. 30204400

Brand: Invitrogen™ RP90482

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52786 (PA5-52786. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LRRN1 gene ontology (GO) annotations include positive regulation of synapse assembly.

Specifications

• Accession Number: Q6UXK5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57633
• Name: Human LRRN1 (aa 383-508) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810047E21Rik; fibronectin type III, immunoglobulin and leucine rich repeat domains 3; FIGLER3; Kiaa1497; leucine rich repeat neuronal 1; leucine rich repeat protein 1, neuronal; leucine-rich repeat neuronal protein 1; LRN; Lrrn1; Nbla10449; Neuronal leucine-rich repeat protein 1; NLRR-1; UNQ693/PRO1338
• Common Name: LRRN1
• Gene Symbol: LRRN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSEQCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQIEDSGRYTCVAQNVQGAD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining