Invitrogen™ Human LRRIQ4 (aa 128-223) Control Fragment Recombinant Protein

Product Code. 30212734

Brand: Invitrogen™ RP108817

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139792 (PA5-139792. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LRRIQ4 (Leucine Rich Repeats And IQ Motif Containing 4) is a Protein Coding gene. Diseases associated with LRRIQ4 include Retinitis Pigmentosa 38. An important paralog of this gene is LRRK1.

Specifications

• Accession Number: A6NIV6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 344657
• Name: Human LRRIQ4 (aa 128-223) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: leucine rich repeat containing 64; leucine rich repeats and IQ motif containing 4; leucine-rich repeat and IQ domain-containing protein 4; Leucine-rich repeat-containing protein 64; leucine-rich repeats and IQ motif containing 4; LRRC64; LRRIQ4
• Common Name: LRRIQ4
• Gene Symbol: LRRIQ4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TDLKEIPVVIFKNLHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQFEVFPQELCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFYMASNNL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining