Invitrogen™ Human LRRFIP2 (aa 237-324) Control Fragment Recombinant Protein

Product Code. 30196268

Brand: Invitrogen™ RP96320

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57481 (PA5-57481. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The leucine-rich repeat FLI-I-interacting protein 2 (LRRFIP2), like the related protein LRRFIP1, was identified in a yeast two-hybrid system through binding to the LRR domain of human FLI. It can activate the Wnt signaling pathway in cultured cells and is thought to be a component of the Wnt signaling pathway that modulates Wnt signaling through interactions with Disheveled to increase the cellular levels and transcription activity of beta-catenin. LRRFIP2 has recently been characterized as a positive regulator of the TLR4 signaling pathway for activating NF-kappa-B during the early host response to LPS stimulation through binding to the TLR adaptor protein MyD88, and that this interaction with MyD88 is governed by phosphorylation of specific residues in LRRFIP2.

Specifications

• Accession Number: Q9Y608
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9209
• Name: Human LRRFIP2 (aa 237-324) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5133400F20Rik; AI850587; HUFI-2; leucine rich repeat (in FLII) interacting protein 2; leucine-rich repeat flightless-interactin protein 2-like protein; leucine-rich repeat flightless-interacting protein 2; LRR binding FLII interacting protein 2; LRR FLII-interacting protein 2; LRRFIP2
• Common Name: LRRFIP2
• Gene Symbol: LRRFIP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PGFTNDDTASIVSSDRASRGRRESVVSAADYFSRSNRRGSVVSEVDDISIPDLSSLDEKSDKQYAENYTRPSSRNSASATTPLSGNSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining