Invitrogen™ Human LRRC66 (aa 608-745) Control Fragment Recombinant Protein

Product Code. 30194521

Brand: Invitrogen™ RP91060

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53191 (PA5-53191. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions.

Specifications

• Accession Number: Q68CR7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 339977
• Name: Human LRRC66 (aa 608-745) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: leucine rich repeat containing 66; leucine-rich repeat-containing protein 66; LRRC66
• Common Name: LRRC66
• Gene Symbol: LRRC66
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTEQSLWDSQMEFSKERQVSSSIDLLSIQQPRLSGARAEEALSAHYSEVPYGDPRDTGPSVFPPRWDSGLDVTPANKEPVQKSTPSDTCCELESDCDSDEGSLFTLSSISSESARSKTEEAVPDEESLQDESSGASKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining