Invitrogen™ Human LRRC6 (aa 370-451) Control Fragment Recombinant Protein

Product Code. 30196837

Brand: Invitrogen™ RP93781

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55756 (PA5-55756. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.

Specifications

• Accession Number: Q86X45
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23639
• Name: Human LRRC6 (aa 370-451) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CILD19; leucine rich repeat containing 6; leucine rich repeat containing 6 (testis); leucine-rich repeat-containing 6 (testis); leucine-rich repeat-containing protein 6; leucine-rich repeat-containing protein 6; protein tilB homolog; leucine-rich testis-specific protein; LRRC6; Lrtp; Mc2; Protein tilB homolog; testis-specific leucine-rich repeat protein; Tslrp; Unknown (protein for MGC:138048)
• Common Name: LRRC6
• Gene Symbol: LRRC6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TTGHLVICMPKVGEVITGGQRAFKSMKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPEPKIIPSE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining