Invitrogen™ Human LRRC38 (aa 138-210) Control Fragment Recombinant Protein

Product Code. 30195904

Brand: Invitrogen™ RP95666

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58536 (PA5-58536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). Modulates gating properties by producing a marked shift in the BK channel's voltage dependence of activation in the hyperpolarizing direction, and in the absence of calcium.

Specifications

• Accession Number: Q5VT99
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 126755
• Name: Human LRRC38 (aa 138-210) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A230053A07Rik; BK channel auxiliary gamma subunit LRRC38; BK channel auxilliary gamma subunit LRRC38; leucine rich repeat containing 38; leucine-rich repeat-containing protein 38; LRRC38
• Common Name: LRRC38
• Gene Symbol: LRRC38
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASKLPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining