missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208658

Invitrogen™ Human LRRC16A (aa 862-942) Control Fragment Recombinant Protein

Product Code. 30208658
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208658

Brand: Invitrogen™ RP94631

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56044 (PA5-56044. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cell membrane-cytoskeleton-associated protein that plays a role in the regulation of actin polymerization at the barbed end of actin filaments. Prevents F-actin heterodimeric capping protein (CP) activity at the leading edges of migrating cells, and hence generates uncapped barbed ends and enhances actin polymerization, however, seems unable to nucleate filaments (PubMed:16054028). Plays a role in lamellipodial protrusion formations and cell migration (PubMed:19846667). [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5VZK9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55604
Name Human LRRC16A (aa 862-942) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110037D04Rik; AI425970; capping protein regulator and myosin 1 linker 1; Capping protein regulator and myosin 1 linker protein 1; Capping protein, Arp2/3 and myosin-I linker homolog 1; capping protein, Arp2/3 and myosin-I linker protein 1; capping protein, Arp2/3, and Myosin-I Linker homolog 1; CARMIL; CARMIL homolog; CARMIL1; CARMIL1a; CARML1; D130057M20; dJ501N12.1; dJ501N12.5; F-actin-uncapping protein LRRC16A; leucine rich repeat containing 16; leucine rich repeat containing 16 A; leucine-rich repeat-containing protein 16 A; Lrrc16; LRRC16A; testicular tissue protein Li 107
Common Name LRRC16A
Gene Symbol CARMIL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.