missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202684

Invitrogen™ Human LRP5 (aa 1410-1533) Control Fragment Recombinant Protein

Product Code. 30202684
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202684

Brand: Invitrogen™ RP102570

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LDL related proteins, LRP 5 and LRP 6, are members of the LDL receptor superfamily, which were found to be involved in the canonical Wnt signaling pathway. Mammalian LRP 6 was shown to bind to Wnt 1 and enhance Wnt-induced developmental processes in Xenopus embryos. Mice lacking LRP 6 exhibited developmental defects that are similar to those caused by deficiencies in various Wnt proteins. Recent work also shows that Wnt proteins induce the binding of LRP 5 to Axin, leading Axin degradation and beta catenin stabilization.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75197
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4041
Name Human LRP5 (aa 1410-1533) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BMND1; EVR1; EVR4; HBM; HGNC:6697; LDL receptor related protein 5; low density lipoprotein receptor-related protein 5; low density lipoprotein receptor-related protein 7; low-density lipoprotein receptor-related protein 5; Low-density lipoprotein receptor-related protein 7; LR3; Lrp5; LRP-5; LRP7; LRP-7; mKIAA4142; OPPG; OPS; OPTA1; VBCH2
Common Name LRP5
Gene Symbol LRP5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYII
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.