Invitrogen™ Human LRIG2 (aa 852-1050) Control Fragment Recombinant Protein

Product Code. 30200744

Brand: Invitrogen™ RP90612

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53318 (PA5-53318. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: O94898
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9860
• Name: Human LRIG2 (aa 852-1050) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4632419I10Rik; BB096938; Kiaa0806; leucine rich repeats and immunoglobulin like domains 2; leucine-rich repeats and immunoglobulin like domains 2; leucine-rich repeats and immunoglobulin-like domains 2; leucine-rich repeats and immunoglobulin-like domains protein 2; LIG2; LIG-2; Lrig2; UFS2
• Common Name: LRIG2
• Gene Symbol: Lrig2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRVICSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTALESLIPSANREPSAFPTNHERISEKKLPSTQMSGETLQRPVWNINRELGLPHPPFSQQPVHESPQLHQNEGLAGREPDCSASSMSCHRLQDHAF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining