Invitrogen™ Human LRCH3 (aa 626-708) Control Fragment Recombinant Protein

Product Code. 30194349

Brand: Invitrogen™ RP90560

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52933 (PA5-52933. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LRCH3 (Leucine Rich Repeats And Calponin Homology Domain Containing 3) is a Protein Coding gene.

Specifications

• Accession Number: Q96II8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84859
• Name: Human LRCH3 (aa 626-708) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210409B11Rik; AW215594; DISP complex protein LRCH3; Gm1742; leucine rich repeats and calponin homology domain containing 3; leucine-rich repeat and calponin homology domain-containing protein 3; leucine-rich repeats and calponin homology (CH) domain containing 3; LRCH3; MGC4126
• Common Name: LRCH3
• Gene Symbol: Lrch3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HASPLPPSAAPTTDSTDSITGQNSRQREEELELIDQLRKHIEYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining