Invitrogen™ Human LRCH2 (aa 498-595) Control Fragment Recombinant Protein

Product Code. 30195845

Brand: Invitrogen™ RP109954

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145148 (PA5-145148. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Leucine rich repeat and calponin homology domain containing protein 2 (LRCH2) also named as KIAA1495 is a 765 amino acid protein, which contains one CH domain and nine LRR repeats. The function of LRCH2 is still non-known.

Specifications

• Accession Number: Q5VUJ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57631
• Name: Human LRCH2 (aa 498-595) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI316885; dA204F4.4; Kiaa1495; leucine rich repeats and calponin homology domain containing 2; leucine-rich repeat and calponin homology domain-containing protein 2; leucine-rich repeats and calponin homology (CH) domain containing 2; Lrch2; mKIAA1495
• Common Name: LRCH2
• Gene Symbol: LRCH2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIRKEYFKYKSMRKSSSGNENDEQDSDNANMSTQSPVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining