Invitrogen™ Human LPP (aa 48-179) Control Fragment Recombinant Protein

Product Code. 30200791

Brand: Invitrogen™ RP90640

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53590 (PA5-53590. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a subfamily of LIM domain proteins that are characterized by an N-terminal proline rich region and three C-terminal LIM domains. The encoded protein localizes to the cell periphery in focal adhesions and may be involved in cell-cell adhesion and cell motility. This protein also shuttles through the nucleus and may function as a transcriptional co-activator. This gene is located at the junction of certain disease related chromosomal translocations which result in the expression of chimeric proteins that may promote tumor growth. Alternate splicing results in multiple transcript variants.

Specifications

• Accession Number: Q93052
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4026
• Name: Human LPP (aa 48-179) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9430020K16Rik; AA959454; AU024130; B130055L10Rik; C79715; D630048H16; I79_000864; LIM domain containing preferred translocation partner in lipoma; LIM domain-containing preferred translocation partner in lipoma; LIM protein; lipoma preferred partner; Lipoma-preferred partner; Lipoma-preferred partner homolog; Lipoma-preferred-partner; LPP
• Common Name: LPP
• Gene Symbol: LPP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVAPKPKYNPYKQPGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining