missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LPHN1 (aa 1182-1243) Control Fragment Recombinant Protein

Product Code. 30210474
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30210474 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30210474 Supplier Invitrogen™ Supplier No. RP95303

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58189 (PA5-58189. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Adgrl1 (Latrophilin-1) is a calcium-independent receptor of high affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Adgrl1 is a receptor for TENM2 that mediates heterophilic synaptic cell-cell contact and postsynaptic specialization, and may be implicated in the regulation of exocytosis. The Adgrl1 gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. Adgrl1 has been shown to recruit the neurotoxin from black widow spider venom, alpha-latrotoxin, to the synapse plasma membrane. Alternative splicing results in multiple variants encoding distinct isoforms of Adgrl1. Diseases associated with ADGRL1 include Dermatophytosis and Retinal Degeneration, Late-Onset, Autosomal Dominant.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O94910
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22859
Name Human LPHN1 (aa 1182-1243) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2900070I05Rik; ADGRL1; Adhesion G protein-coupled receptor L1; AI182398; calcium-independent alpha-latrotoxin receptor 1; Cirl; Cirl1; CIRL-1; CL1; CL1BA; CLIBA; KIAA0821; latrophilin 1; latrophilin-1; LEC2; Lectomedin-2; Lphh2; LPHN1; mKIAA0821
Common Name LPHN1
Gene Symbol Adgrl1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNHLLTNPVLQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.