Invitrogen™ Human LPAR4 (aa 320-365) Control Fragment Recombinant Protein

Product Code. 30193926

Brand: Invitrogen™ RP95311

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EDG4 belongs to a family of G-protein coupled receptors whose ligands are lysophospholipids. There are eight known members of the EDG receptor family and they are implicated in mediating growth-related effects such as induction of cellular proliferation, alterations in differentiation and survival, and suppression of apoptosis. They also evoke cellular effector functions that are dependent on cytoskeletal responses such as contraction, secretion, adhesion and chemotaxis. EDG receptors are developmentally regulated and differ in tissue distribution. They couple to multiple types of G proteins to signal through ras and MAP kinase, rho, phospholipase C, and several protein tyrosine kinases. EDG4 is expressed in testes, ovarian tumor, and leukocyte containing tissues.

Specifications

• Accession Number: Q99677
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2846
• Name: Human LPAR4 (aa 320-365) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730485F04Rik; G protein-coupled receptor 23; Gpr23; G-protein coupled receptor 23; LPA receptor 4; LPA4; LPA-4; LPA4 Receptor; Lpar4; Lysophosphatidic acid receptor 4; P2RY9; P2Y purinoceptor 9; P2Y5-LIKE; P2Y5-like receptor; p2y9; Purinergic receptor 9; RGD1563686
• Common Name: LPAR4
• Gene Symbol: Lpar4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining